Buy sermorelin research peptides online in 2mg vial from our store. We guarantee fast shipment and best price for sermorelin purchased online from us.
What is Sermorelin Acetate?
Sermorelin (GHRH) is a bio-identical hormone that has lately been genetically engineered to stimulate the excretion of Growth Hormone Releasing Hormone (GHRH) from the hypothalamus, a gland approach to the pituitary gland. GHRH is a peptide that be comprised of the first 29 amino acids of our own GH. These 29 amino acids are the active amino acids of GHRH. It is GHRH that stimulates the pituitary glands to liberate GH. As aging, the hormones created by the previous pituitary are exhausted. It has now been shown that GHRH can restore the GH-RNA to a youthful level causing elevation of levels of IGF-1.
Product Name:Sermorelin 2mg
Catalogue Number:L648976
Synonyms:Sermorelin Acetate
CAS NO.:86168-78-7
Molecular Formula:C149H246N44O42S
Molecular Weight:3357.88
Sequence:H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
One Letter Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2
Source:Chemical Synthesis
Buy Sermorelin online without a prescription in China. Sermorelin buy, Sermorelin 2mg, Buy Peptides Online, Sermorelin peptides, Sermorelin for sale, buy Sermorelin in our shop, buy research peptides online, buy Sermorelin online at cheap prices, buy Sermorelin china online, Buy Sermorelin online for bodybuilding, Buy Sermorelin. Sermorelin reviews ,Sermorelin for sale online. Buy Peptides for sale online made in the China at 98% purity. Buy cheap SERMORELIN 2mg online from our peptides store. Buy Sermorelin research peptide at high quality. Sermorelin is a growth hormone releasing peptide (GHRP) similar to GHRP2 and GHRP6. Where to Buy Sermorelin, Buy SERMORELIN for sale, Sermorelin side effects, Sermorelin review, Sermorelin bodybuilding, Sermorelin results, Sermorelin benefits. purchase peptides Sermorelin review Large number of other research peptides, best place to buy Sermorelin.
CAUTION:
This product is NOT intended to prevent, treat, or cure disease conditions or to affect the structure or function of the body. The sale of this product is restricted to research applications ONLY. This product is NOT for human consumption. This product can be harmful if ingested. Picture may differ from actual product.